PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10018530m
Common NameCARUB_v10018530mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 269aa    MW: 30726.1 Da    PI: 8.6671
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10018530mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.82.9e-192673148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd+ll ++v+ +G g+W+t+a++ g++R++k+c++rw +yl
  Carubv10018530m 26 KGPWTLEEDKLLGEYVTSHGEGRWSTVAKCAGLNRSGKSCRLRWVNYL 73
                     79********************************************97 PP

2Myb_DNA-binding506.8e-1679123147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg  T++E+ ++++++ ++G++ W+tIar+++ gRt++++k++w+++
  Carubv10018530m  79 RGQITPQEEGIILELHSLWGNK-WSTIARYLP-GRTDNEIKNYWRTH 123
                      7888******************.*********.************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.5842177IPR017930Myb domain
SuperFamilySSF466891.83E-3123120IPR009057Homeodomain-like
SMARTSM007171.3E-142575IPR001005SANT/Myb domain
PfamPF002499.7E-172673IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.5E-232780IPR009057Homeodomain-like
CDDcd001672.77E-112873No hitNo description
PROSITE profilePS5129419.95278128IPR017930Myb domain
SMARTSM007171.8E-1378126IPR001005SANT/Myb domain
PfamPF002499.7E-1479123IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.8E-2481127IPR009057Homeodomain-like
CDDcd001675.88E-1083123No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MIDWGVQGHH QKHDHDPYQQ RQGCRKGPWT LEEDKLLGEY VTSHGEGRWS TVAKCAGLNR  60
SGKSCRLRWV NYLRPGLKRG QITPQEEGII LELHSLWGNK WSTIARYLPG RTDNEIKNYW  120
RTHYKKKEKS CSKPERAKRS QSRKHQVDLK PQPQPQPHNH QSQLVSRDQM NIDKEQNISS  180
PLYYSTSIFN DQLSMPQNVA ATSSDHSMID ESNLWGNLWN LGDDDPYSFG SGLGQRIATD  240
LSEKFPNGGV ETPSCGSGDY SYTGFYIF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-25261277107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00388DAPTransfer from AT3G30210Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006292319.10.0hypothetical protein CARUB_v10018530mg
TrEMBLR0FRJ40.0R0FRJ4_9BRAS; Uncharacterized protein
STRINGAT3G30210.11e-158(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30210.11e-153myb domain protein 121